The domain within your query sequence starts at position 1425 and ends at position 1518; the E-value for the DTHCT domain shown below is 1.1e-18.
TAGTKKRAAPKGTKSDSALSARVSEKPAPAKAKNSRKRKPSSSDSSDSDFERAISKGATS KKAKGEEQDFPVDLEDTIAPRAKSDRARKPIKYL
DTHCT |
---|
PFAM accession number: | PF08070 |
---|---|
Interpro abstract (IPR012542): | The DTCHT region is the C-terminal part of DNA gyrases B / topoisomerase IV / HATPase proteins [ (PUBMED:15112237) ]. This region is composed of quite low complexity sequence. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DTHCT