The domain within your query sequence starts at position 1425 and ends at position 1518; the E-value for the DTHCT domain shown below is 1.1e-18.

TAGTKKRAAPKGTKSDSALSARVSEKPAPAKAKNSRKRKPSSSDSSDSDFERAISKGATS
KKAKGEEQDFPVDLEDTIAPRAKSDRARKPIKYL

DTHCT

DTHCT
PFAM accession number:PF08070
Interpro abstract (IPR012542):

The DTCHT region is the C-terminal part of DNA gyrases B / topoisomerase IV / HATPase proteins [(PUBMED:15112237)]. This region is composed of quite low complexity sequence.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DTHCT