The domain within your query sequence starts at position 35 and ends at position 144; the E-value for the DUF1057 domain shown below is 3.3e-9.
WKTSGKFFTYKGLRIFYQDSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIAL DFLGFGFSDKPRPHQYSIFEQASIVESLLRHLGLQNRRINLLSHDYGDIV
DUF1057 |
 |
|---|
| PFAM accession number: | PF06342 |
|---|---|
| Interpro abstract (IPR010463): | This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1057