The domain within your query sequence starts at position 10 and ends at position 155; the E-value for the DUF1075 domain shown below is 1.8e-69.
AAGHCLRLYERNASSSLRFTRNTDLKRINGFCTKPQESPKTPTQSYRHGVPLHKPTDFEK KILLWSGRFKKEEEIPETISFEMLDAAKNKLRVKVSYLMIALTVAGCIYMVIEGKKAAKR HESLTSLNLERKARLREEAAMKAKTD
DUF1075 |
---|
PFAM accession number: | PF06388 |
---|---|
Interpro abstract (IPR009432): | This family consists of several eukaryotic proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1075