The domain within your query sequence starts at position 56 and ends at position 170; the E-value for the DUF1077 domain shown below is 2.6e-49.
SVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMA ISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEP
DUF1077 |
 |
|---|
| PFAM accession number: | PF06417 |
|---|---|
| Interpro abstract (IPR009445): | This entry includes TMEM85 from mammals and Emc4 from budding yeasts. They inhibit hydrogen peroxide mediated cell death in yeast [ (PUBMED:18586032) ]. Emc4 is part of the ER membrane complex (EMC) that may play a role in protein folding [ (PUBMED:23431131) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1077