The domain within your query sequence starts at position 144 and ends at position 262; the E-value for the DUF1115 domain shown below is 1.7e-9.
LRLDHMRARTKYVKAVEKWASELRLTGRLMFMGKLILILLQGDRSNIKEYLILQKTSKVD VDSSGKKCKEKMISVLSETKVQTEHKRFLAFEVKEYSTLEELQKEFGAAGLGELFSECV
DUF1115 |
![]() |
---|
PFAM accession number: | PF06544 |
---|---|
Interpro abstract (IPR010541): | This entry represents the C terminus of several eukaryotic RWD domain-containing proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1115