The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the DUF1143 domain shown below is 7.7e-107.
MAVSCSLNHSTYLQRQNLVCYLRNPHYGSLIYADGHGEVWTDWNDMSKFLQYGWRCTTNE NSYSNRTLVGNWNQERYDLKNIVKPKPLPSQFGHAFETTYDANYSRKKPQSTHRFKREPH WFPGHQPELDPPHYKCTAKSTYMTNYSEP
DUF1143 |
---|
PFAM accession number: | PF06608 |
---|---|
Interpro abstract (IPR009524): | This family consists of several hypothetical mammalian proteins (from mouse and human). The function of this family is unknown. |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1143