The domain within your query sequence starts at position 68 and ends at position 126; the E-value for the DUF1143 domain shown below is 5.3e-38.
LFGHAFETTYDANYSRKKPQSTHRFKREPHWFPGHQPELDPPHYKCTAKSTYMTNYSEP
DUF1143 |
 |
|---|
| PFAM accession number: | PF06608 |
|---|---|
| Interpro abstract (IPR009524): | This family consists of several hypothetical mammalian proteins (from mouse and human). The function of this family is unknown. |
| GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1143