The domain within your query sequence starts at position 337 and ends at position 515; the E-value for the DUF1170 domain shown below is 8.2e-87.

ISTPTKRDSSALQDLYIPPPPAEPYIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLD
QEYRKRFNIVEEDTVLYCYEYEKGRSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPN
KMKRDSRRENSLLRYMSNEKIAQEEYMFQRNSKKDTGKKSKKKGDKSNSPAHYSLLPSL

DUF1170

DUF1170
PFAM accession number:PF06663
Interpro abstract (IPR010599):

This region of unknown function is situated between the IPR001478 and IPR001849 domains in a cytoplasmic and membrane associated protein which appears to function as an adapter protein or regulator of Ras signalling pathways [(PUBMED:14597674)].

GO process:regulation of signal transduction (GO:0009966)
GO component:cytoplasm (GO:0005737), membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1170