The domain within your query sequence starts at position 11 and ends at position 108; the E-value for the DUF1180 domain shown below is 4.3e-11.
LLWCSNPGSAENSSLPGPPYNHTNGRLPDRDTGSAVLRLFYVITGLCGLISLYFLIRAFR LKKSQRRRYGLLTNTEEHEEMASQDSEEETVFETRNLR
DUF1180 |
---|
PFAM accession number: | PF06679 |
---|---|
Interpro abstract (IPR009565): | This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1180