The domain within your query sequence starts at position 85 and ends at position 172; the E-value for the DUF1279 domain shown below is 4e-30.
QQLKKVFQEYGAVGVSMHIGISLVSLGIFYTVVSSGIDMSAILLKLGFKESLVQSKMAAG TSTFVVAYAIHKLFAPVRISITLVSVPF
DUF1279 |
 |
|---|
| PFAM accession number: | PF06916 |
|---|---|
| Interpro abstract (IPR009688): | This entry represents the C terminus (approx. 120 residues) of a number of eukaryotic proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1279