The domain within your query sequence starts at position 38 and ends at position 401; the E-value for the DUF1308 domain shown below is 2.2e-115.

LCSKLKAELKFLQKIEAGKVAIKESHLQSTNLTHLKAIVESAENLEEVVSVLRVFGYTDT
LGEKQTLVVDVVANGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASRQQP
VQYSNPHIVFAFYNSVSSPMADKLKDMGISVRGDIVAVNSLLNHPEEFQLSESESDDEGQ
ELLQVTRVDRDNVLARVAFPTEIKVDVCKKVNLDITTLITYVSAMSYGGCHFVFKEKVLT
EQAEQERKERVLPQLEAFMKDKELFACESAVKDFQSILDTLGGPGERERADVLIKRISVV
PDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQP
RALT

DUF1308

DUF1308
PFAM accession number:PF07000
Interpro abstract (IPR010733):

This family consists of several hypothetical eukaryotic sequences of around 400 residues in length. The function of this family is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1308