The domain within your query sequence starts at position 14 and ends at position 70; the E-value for the DUF1356 domain shown below is 3.3e-18.

KEDGYDGVTSTDNMRNGLVSSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGR

DUF1356

DUF1356
PFAM accession number:PF07092
Interpro abstract (IPR009790):

This family consists of several hypothetical mammalian proteins of around 250 residues in length. The function of this family is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1356