The domain within your query sequence starts at position 1 and ends at position 117; the E-value for the DUF1358 domain shown below is 7.8e-50.
METSGPGPGESSELEAPGSPDDRLFLVKGGIFLGSAAAAGMLAGFVTTLSLAKKKSPEWF NKGTMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSALFDCREET
DUF1358 |
---|
PFAM accession number: | PF07096 |
---|---|
Interpro abstract (IPR009792): | This family consists of several hypothetical eukaryotic proteins of around 125 residues in length. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1358