The domain within your query sequence starts at position 79 and ends at position 130; the E-value for the DUF1387 domain shown below is 4.2e-13.

WNMTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEVGPLQPQAPLVQNGHMNG

DUF1387

DUF1387
PFAM accession number:PF07139
Interpro abstract (IPR009816):

This family represents a conserved region approximately 300 residues long within a number of hypothetical proteins of unknown function that seem to be restricted to mammals.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1387