The domain within your query sequence starts at position 59 and ends at position 303; the E-value for the DUF1394 domain shown below is 5.4e-12.

YIEQATVHSSMNEMLEEGHDYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPE
VTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMK
CSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELL
ADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKF
FKQLQ

DUF1394

DUF1394
PFAM accession number:PF07159
Interpro abstract (IPR009828):

This family consists of several hypothetical eukaryotic proteins of around 320 residues in length. The function of this family is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1394