The domain within your query sequence starts at position 29 and ends at position 98; the E-value for the DUF1604 domain shown below is 2.2e-37.

KKPIPLQDQTVRDEKGRYKRFHGAFSGGFSAGYFNTVGSKEGWTPSTFVSSRQNRADKSA
LGPEDFMDEE

DUF1604

DUF1604
PFAM accession number:PF07713
Interpro abstract (IPR011666): This domain is found at the N terminus of several eukaryotic RNA processing proteins, including Arabidopsis TGH, which is involved in microRNA (miRNA) and small interfering RNA (siRNA) biogenesis [(PUBMED:22802657)].
GO process:mRNA processing (GO:0006397)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1604