The domain within your query sequence starts at position 78 and ends at position 364; the E-value for the DUF1619 domain shown below is 3e-74.

CVCDLTPGTCDLNCCCDKDCDLLHPRTVFSFCLPGSVRSSSWVCVDNSLMFRSNSPFPSR
VFTDSSGTTQFCVRVNNSKANYFQKLQTVNATNFQALAAEFGGQSFPSMPPETQPPVLFY
RAGDPILTYYPSWSVVSLLRQPAAVGAGGLCAESNPAGFLESKSTTCPRFFRDLASSCTS
EPALDAASYYNFRVLKVPRGVTDLQNMKFQVPVTLASQASPPLLAGNTCQNIVSQVVYEI
ETNGTFGIQKVSVSFRQTNLTVKPGVSLQQDFIVHFRVSSLPSERVQ

DUF1619

DUF1619
PFAM accession number:PF07773
Interpro abstract (IPR011677): This is a group of sequences derived from hypothetical eukaryotic proteins. The region in question is approximately 330 residues long and has a cysteine rich N terminus.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1619