The domain within your query sequence starts at position 791 and ends at position 996; the E-value for the DUF1620 domain shown below is 1.1e-77.

SENWVVYQYWNSKARRNELTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFPSSISA
MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQVHA
ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLIS
SVLFGLVFATMITKRLAQVKLLNRAW

DUF1620

DUF1620
PFAM accession number:PF07774
Interpro abstract (IPR011678): This entry represents the C-terminal domain of ER membrane protein complex subunit 1. ER membrane protein complex subunit 1 is a component of the ER membrane protein complex (EMC, composed of EMC1, EMC2, EMC3, EMC4, EMC5 and EMC6). In Saccharomyces cerevisiae, the EMC seems to be required for efficient folding of proteins in the endoplasmic reticulum (ER) [(PUBMED:19325107)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1620