The domain within your query sequence starts at position 15 and ends at position 309; the E-value for the DUF1669 domain shown below is 1.8e-120.

NWRSSESKPEFFYSEEQRLALEALVARGRDAFYEVLKRENIRDFLSELELSRIVEAIEVY
DPGSEDPRVSGRRPEPQDNGGADASEETSAAGGPPATETLPSLEYWPQKSDRSIPQLDLG
WPDTIAYRGVTRASVYMQPPIDGQPHIKEVVRKMVSQAQKVIAVVMDMFTDVDIFKDLLD
AGFKRKVAVYIIVDESNVKYFLHMCERARMHLGHLKNLRVRSSGGTEFFTRSATKFKGVL
AQKFMFVDGDRAVCGSYSFTWSAARTDRNVISVLSGQVVEMFDRQFQELYLMSQS

DUF1669

DUF1669
PFAM accession number:PF07894
Interpro abstract (IPR012461):

FAM83 family members include FAM83A-H. They are oncogenes that function as intermediaries in EGFR/RAS signaling [(PUBMED:27221039)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1669