The domain within your query sequence starts at position 6 and ends at position 163; the E-value for the DUF1681 domain shown below is 1.7e-60.

YESVLCVKPEVHVYRIPPRATNRGYRASEWQLDQPSWSGRLRITAKGKVAYIKLEDRTSG
ELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGLGFGDRGDAFDFNVALQDH
FKWVKQQCEFAKQAQNPDEGPKLDLGFKDGQTIKINIA

DUF1681

 DUF1681
PFAM accession number:PF07933
Interpro abstract (IPR012466):

This PH-like domain can be found in the N-terminal region of NECAPs (also known as adaptin ear-binding coat-associated proteins). NECAPs are alpha-ear-binding proteins that enrich on clathrin-coated vesicles (CCVs). NECAP-1 is expressed in brain and non-neuronal tissues and cells while NECAP-2 is ubiquitously expressed. The PH-like domain of NECAPs is a protein-binding interface that mimics the FxDxF motif binding properties of the alpha-ear and is called PHear (PH fold with ear-like function) domain [ (PUBMED:17762867) ].

PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes [ (PUBMED:22728242) (PUBMED:17233582) (PUBMED:15766521) (PUBMED:14594214) (PUBMED:15493994) ].

GO process:endocytosis (GO:0006897)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1681