The domain within your query sequence starts at position 1 and ends at position 212; the E-value for the DUF1682 domain shown below is 1.3e-53.

XDMDTYVFAVGTRKALLRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTEGMM
DTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYP
KDMESLLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRR
EEKKRAEKERIMNEEDPEKQRRLEVRHSEARL

DUF1682

DUF1682
PFAM accession number:PF07946
Interpro abstract (IPR012879):

The members of this family are all hypothetical eukaryotic proteins of unknown function. One member (Q920S6) is described as being an adipocyte-specific protein, but no evidence of this was found.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1682