The domain within your query sequence starts at position 107 and ends at position 201; the E-value for the DUF1726 domain shown below is 6.9e-39.

YNETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTMTMD
VHSRYRTEAHQDVVGRFNERFILSLASCKKCLVID

DUF1726

DUF1726
PFAM accession number:PF08351
Interpro abstract (IPR013562):

This entry represents a domain found in the N terminus of the bacterial tRNA(Met) cytidine acetyltransferase TmcA. TmcA catalyses the formation of N(4)-acetylcytidine (ac4C) at the wobble position of tRNA(Met), by using acetyl-CoA as an acetyl donor and either ATP or GTP [(PUBMED:18668122)]. This modification is thought to ensure precise recognition of the AUG codon by strengthening C-G base-pair interaction and also prevent misrecognition of the near cognate AUA codon [(PUBMED:19322199)].

This domain can also be found in mammalian N-acetyltransferase 10 (NAT10) and fungal protein Kre33. Kre33 and NAT10 are RNA cytosine acetyltransferases with specificity toward both 18S rRNA and tRNAs [(PUBMED:25653167), (PUBMED:25402480)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1726