The domain within your query sequence starts at position 245 and ends at position 291; the E-value for the DUF1731 domain shown below is 5.9e-21.

VPSTVVRAVFGERAIMLLEGQKVVPRRTLATGYQYSFPELRAALKDV

DUF1731

 DUF1731
PFAM accession number:PF08338
Interpro abstract (IPR013549):

This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family ( IPR001509 ) in bacteria, eukaryotes and archaea.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1731