The domain within your query sequence starts at position 13 and ends at position 48; the E-value for the DUF1744 domain shown below is 2.7e-13.

EVHFIHSKEIFHSLTISFSRCWEFLLWMDPSNYGGI

DUF1744

DUF1744
PFAM accession number:PF08490
Interpro abstract (IPR013697):

This domain is found on the catalytic subunit of DNA polymerase epsilon. It is found C-terminal to IPR006133 and IPR006134.

GO process:DNA replication (GO:0006260)
GO component:nucleus (GO:0005634)
GO function:zinc ion binding (GO:0008270), DNA-directed DNA polymerase activity (GO:0003887)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1744