The domain within your query sequence starts at position 3 and ends at position 58; the E-value for the DUF1754 domain shown below is 2.8e-10.

AYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKMLEAMGTSKKSEEEKRRCLDKR

DUF1754

 DUF1754
PFAM accession number:PF08555
Interpro abstract (IPR013865):

FAM32A, also known as OTAG12, has been linked to ovarian tumour in humans and mice [ (PUBMED:21339736) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1754