The domain within your query sequence starts at position 85 and ends at position 361; the E-value for the DUF1776 domain shown below is 3.2e-13.

AVLVTGADSGFGHGLAKHLDKLGFTVFAGVLDKEGPGAEELRKHCSERLSVLQMDVTKPE
QIKDAHSKVTEKIQDKGLWAVVNNAGVFHLPIDGELIPMSIYRKCMAVNFFGTVEVTKAF
LPLLRKSKGRLVNVSSMGGTVPLQMTSAYAATKAALTMFSTIIRQELDKWGVKVVTIKPG
GFKTNITGSQDIWDKMEKEILDHFSKDIQENYGQDYVHTQKLIIPTLKERSNPDITPVLR
DIQHAISARNPSSFYYPGRMAYLWVCLAAYCPTSLLD

DUF1776

DUF1776
PFAM accession number:PF08643
Interpro abstract (IPR013952):

This is a fungal protein of unknown function. One of the proteins P32792 has been localised to the mitochondria [(PUBMED:14576278)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1776