The domain within your query sequence starts at position 1 and ends at position 139; the E-value for the DUF1777 domain shown below is 1.9e-24.

MGRSRSRSPRRERRRSRSTSRDRERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRST
SPSPSRLKERRDEEKKETKEIKNKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKV
DGSVNAYAINVSQKRKYRY

DUF1777

DUF1777
PFAM accession number:PF08648
Interpro abstract (IPR013957): U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein may play a role in mRNA splicing [(PUBMED:9085842)].
GO process:RNA splicing (GO:0008380)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1777