The domain within your query sequence starts at position 412 and ends at position 567; the E-value for the DUF1794 domain shown below is 1.3e-52.

PVVEPLSWMLGTWLSDPPGVGTFPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPETHKPM
HRECGFIRLKPDTNKVAFVSAQNTGIVEVEEGEVNGQELCVSSHSVSRISFAKEPHVEQI
TRKFRLNSEGKLEQTVSMATTTQPMTQHLHITYKKV

DUF1794

 DUF1794
PFAM accession number:PF08768
Interpro abstract (IPR014878):

Nitrobindin is a heme-containing lipocalin that may reversibly bind nitric oxide. This heme-binding domain forms a beta barrel structure, and in a small family of proteins from tetrapods, it is found C-terminal to a THAP zinc finger domain (a sequence-specific DNA binding domain). Members of this group are putatively related to fatty acid-binding proteins (FABPs) [ (PUBMED:17172346) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1794