The domain within your query sequence starts at position 1 and ends at position 37; the E-value for the DUF1891 domain shown below is 4.9e-18.
MNINHKGVLKLTKMEKKFLRKQSKARHVLLKHEGIQA
DUF1891 |
---|
PFAM accession number: | PF09004 |
---|---|
Interpro abstract (IPR015095): | This domain is found at the extreme N terminus of eukaryotic alkylated DNA repair protein homologues. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | methyltransferase activity (GO:0008168), 2-oxoglutarate-dependent dioxygenase activity (GO:0016706) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1891