The domain within your query sequence starts at position 1 and ends at position 37; the E-value for the DUF1891 domain shown below is 4.9e-18.

MNINHKGVLKLTKMEKKFLRKQSKARHVLLKHEGIQA

DUF1891

DUF1891
PFAM accession number:PF09004
Interpro abstract (IPR015095):

This domain is found at the extreme N terminus of eukaryotic alkylated DNA repair protein homologues.

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706), methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1891