The domain within your query sequence starts at position 141 and ends at position 423; the E-value for the DUF1908 domain shown below is 1.3e-151.

PLDSPRNFSPNAPAHFSFVPARSHGHRTDRTDGRRWSLASLPSSGYGTNTPSSTVSSSCS
SQEKLHQLPFQPTADELHFLTKHFSTENVPDEEGRRSPAMRPRSRSLSPGRSPVSFDSEI
IMMNHVYKERFPKATAQMEERLADFISSNTPDSVLPLADGALSFIHHQVIEMARDCLDKS
RSGLITSHYFYELQENLEKLLQDAHERSESSDVAFVIQLVKKLMIIIARPARLLECLEFD
PEEFYHLLEAAEGHAKEGHGIKCDIPRYIVSQLGLTRDPLEEM

DUF1908

DUF1908
PFAM accession number:PF08926
Interpro abstract (IPR015022):

This domain is found in microtubule-associated serine/threonine-protein kinases.

GO process:protein phosphorylation (GO:0006468)
GO function:protein serine/threonine kinase activity (GO:0004674), ATP binding (GO:0005524), magnesium ion binding (GO:0000287)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1908