The domain within your query sequence starts at position 57 and ends at position 144; the E-value for the DUF1908 domain shown below is 2.3e-38.
PLDSPRNFSPNAPAHFSFVPARRTDGRRWSLASLPSSGYGTNTPSSTVSSSCSSQEKLHQ LPFQPTADELHFLTKHFSTENVPDEEGR
DUF1908 |
---|
PFAM accession number: | PF08926 |
---|---|
Interpro abstract (IPR015022): | This domain is found in microtubule-associated serine/threonine-protein kinases. |
GO process: | protein phosphorylation (GO:0006468) |
GO function: | magnesium ion binding (GO:0000287), protein serine/threonine kinase activity (GO:0004674), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1908