The domain within your query sequence starts at position 58 and ends at position 203; the E-value for the DUF1908 domain shown below is 2.9e-74.
PLDSPRNFSPNAPAHFSFVPARSHGHRTDRTDGRRWSLASLPSSGYGTNTPSSTVSSSCS SQEKLHQLPFQPTADELHFLTKHFSTENVPDEEGRRSPAMRPRSRSLSPGRSPVSFDSEI IMMNHVYKERFPKATAQMEERLADFI
DUF1908 |
![]() |
---|
PFAM accession number: | PF08926 |
---|---|
Interpro abstract (IPR015022): | This domain is found in microtubule-associated serine/threonine-protein kinases. |
GO process: | protein phosphorylation (GO:0006468) |
GO function: | magnesium ion binding (GO:0000287), ATP binding (GO:0005524), protein serine/threonine kinase activity (GO:0004674) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1908