The domain within your query sequence starts at position 7 and ends at position 88; the E-value for the DUF1968 domain shown below is 1.6e-39.

PAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWS
NQTSFTCQDIFKETNATYPSSD

DUF1968

DUF1968
PFAM accession number:PF09291
Interpro abstract (IPR015370):

This entry represents the constant domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N terminus of each chain [ (PUBMED:18800968) (PUBMED:17011774) (PUBMED:17560120) ]. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1968