The domain within your query sequence starts at position 1174 and ends at position 1257; the E-value for the DUF1981 domain shown below is 6e-38.

KFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVIRCIAQMVSSQAANIRSGWKNIF
AVFHQAASDHDGNIVELAFQTTGH

DUF1981

DUF1981
PFAM accession number:PF09324
Interpro abstract (IPR015403):

This domain is found in the C-terminal of the protein transport protein Sec7. Sec7 is involved in the secretory pathway as a protein binding scaffold for the COPII-COPI protein switch for maturation of the VTC intermediate compartments for Golgi compartment biogenesis [(PUBMED:11208097)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1981