The domain within your query sequence starts at position 1217 and ends at position 1300; the E-value for the DUF1981 domain shown below is 3.6e-39.
KFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIF SVFHLAASDQDESIVELAFQTTGH
DUF1981 |
 |
|---|
| PFAM accession number: | PF09324 |
|---|---|
| Interpro abstract (IPR015403): | This domain is found in the C-terminal of the protein transport protein Sec7. Sec7 is involved in the secretory pathway as a protein binding scaffold for the COPII-COPI protein switch for maturation of the VTC intermediate compartments for Golgi compartment biogenesis [ (PUBMED:11208097) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1981