The domain within your query sequence starts at position 331 and ends at position 401; the E-value for the DUF2012 domain shown below is 5.7e-10.

PDGEGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIHAQKEHLYFEMVTIKIAPNTP
QLADLIATGFS

DUF2012

DUF2012
PFAM accession number:PF09430
Interpro abstract (IPR019008):

This domain is found in different proteins, including uncharacterised protein family UPF0480 and nodal modulators. A nodal modulator has been identified as part of a protein complex that participates in the nodal signaling pathway during vertebrate development [(PUBMED:15257293)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2012