The domain within your query sequence starts at position 190 and ends at position 322; the E-value for the DUF2028 domain shown below is 2.8e-64.

EVPQLNFGMADPTQMGGLSMLLLAGEHALGTPEASSGTCRPDISESPELRQKSPLFQFAE
ISSRTSHPDAPSKQCQASALFQFAEISSSTSQLGGTEPVKRCGNSALFQLAEMCLASEGV
KMEDTKLIKSKES

DUF2028

DUF2028
PFAM accession number:PF09667
Interpro abstract (IPR019102):

This entry represents a conserved domain found the in HMG box transcription factor BBX. This protein is necessary for cell cycle progression from the G1 to the S phase [(PUBMED:11680820)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2028