The domain within your query sequence starts at position 190 and ends at position 335; the E-value for the DUF2028 domain shown below is 9.2e-54.
EVPQLNFGMADPTQMGGLSMLLLAGEHALGTPEASSGTCRPDISESPELRQKSPLFQFAE ISSRTSHPDAPSKQCQASALFQFAEISSSTSQLGGTEPVKRCGNSALFQLAEMCLASEGV KMEDTKLIKSKESDGGRIEEIEKGKE
DUF2028 |
---|
PFAM accession number: | PF09667 |
---|---|
Interpro abstract (IPR019102): | This entry represents a conserved domain found the in HMG box transcription factor BBX. This protein is necessary for cell cycle progression from the G1 to the S phase [ (PUBMED:11680820) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2028