The domain within your query sequence starts at position 57 and ends at position 176; the E-value for the DUF2040 domain shown below is 1.1e-40.
TKLEIQKALAEDSTVYEYDSVYDEMQKKKEENNPKLLPGKDRKPKYIHNLLKAVEIRKKE QEKRMEKKIQREREMENGEFDDKEAFVTSAYKKKLEERAEEEEREKRAAALEAHLDVTKQ
DUF2040 |
![]() |
---|
PFAM accession number: | PF09745 |
---|---|
Interpro abstract (IPR018612): | This entry represents a conserved domain of approximately 130 residues of proteins conserved from fungi to humans. Some proteins containing this domain are described as coiled-coil domain-containing protein 55, but the function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2040