The domain within your query sequence starts at position 1 and ends at position 75; the E-value for the DUF2048 domain shown below is 1.1e-36.
MAHYVPGIMPIESVVARFQFIVPKEWNSRYRPVCIHLAGTGDHHYWRRRTLMARPMIKEA RMASLLLENPYYILL
DUF2048 |
 |
|---|
| PFAM accession number: | PF09752 |
|---|---|
| Interpro abstract (IPR019149): | This entry represents abhydrolase domain containing 18 (ABHD18). Its function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2048