The domain within your query sequence starts at position 16 and ends at position 67; the E-value for the DUF2048 domain shown below is 2.2e-17.

TKLFIRGWGRPEDLKRLFEFRKMIGNRERCQNLVSSDYPVHIDKAPEGSIIQ

DUF2048

DUF2048
PFAM accession number:PF09752
Interpro abstract (IPR019149):

This entry represents abhydrolase domain containing 18 (ABHD18). Its function is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2048