The domain within your query sequence starts at position 16 and ends at position 67; the E-value for the DUF2048 domain shown below is 2.9e-16.
TKLFIRGWGRPEDLKRLFEFRKMIGNRERCQNLVSSDYPVHIDKAPEGSIIQ
DUF2048 |
![]() |
---|
PFAM accession number: | PF09752 |
---|---|
Interpro abstract (IPR019149): | This entry represents abhydrolase domain containing 18 (ABHD18). Its function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2048