The domain within your query sequence starts at position 156 and ends at position 327; the E-value for the DUF2052 domain shown below is 4.1e-54.
NRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLTQEELNARTAAPQAPRSGSPGT PAYPLSDLLFQSYQERELQQKLLQQQEEEEACFEEEEDSDEEDQRSDKDSEAWVPDSEER LILREEFTSRMHQRFLDGKDGGFDYSTVDDNPDFDNLDIVARDEEDRYFDEE
DUF2052 |
---|
PFAM accession number: | PF09747 |
---|---|
Interpro abstract (IPR040233): | This domain is found in some proteins as two conserved domains separated by a region of low complexity, spanning some 200 residues. The function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2052