The domain within your query sequence starts at position 156 and ends at position 327; the E-value for the DUF2052 domain shown below is 4.1e-54.

NRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLTQEELNARTAAPQAPRSGSPGT
PAYPLSDLLFQSYQERELQQKLLQQQEEEEACFEEEEDSDEEDQRSDKDSEAWVPDSEER
LILREEFTSRMHQRFLDGKDGGFDYSTVDDNPDFDNLDIVARDEEDRYFDEE

DUF2052

DUF2052
PFAM accession number:PF09747
Interpro abstract (IPR018613):

This entry includes coiled-coil domain-containing proteins of unkown function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2052