The domain within your query sequence starts at position 592 and ends at position 642; the E-value for the DUF2075 domain shown below is 1.9e-7.

TRELFVHGLPGSGKTIIAMKIMEKIRNTFHCETDRILYICENQPLRDFIQ

DUF2075

DUF2075
PFAM accession number:PF09848
Interpro abstract (IPR018647):

This domain, found in putative ATP/GTP binding proteins, has no known function. It is found in some proteins described as Schlafen family members, which may have a role in hematopoeitic cell differentiation [ (PUBMED:15351786) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2075