The domain within your query sequence starts at position 94 and ends at position 313; the E-value for the DUF2151 domain shown below is 6e-59.
TVVPLAGVIVKESLTEEDVLNCQKTIYNLVDMERKNDPLPVSTVGTRGKGPKRDEQYRIM WNELETLVRAHISNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDREDKSEQAGKEHG TEKARPDADRLKGILERGKEELAEAEVIKDSPDSPEPPNKKPLVETDETPHMEKSKGPVS LLSLWSNRINTANSRKHQEFAGRLNSVNNRAELYQHLKEE
DUF2151 |
---|
PFAM accession number: | PF10221 |
---|---|
Interpro abstract (IPR019355): | This entry represents the cell cycle regulator Mat89b (also known as protein asunder), which plays an evolutionarily conserved role as a crucial regulator of both cell cycle and development [ (PUBMED:15737938) ]. Mat89Bb is a PNG kinase substrate that is essential for S-M cycles of early Drosophila embryogenesis, Xenopus embryonic cell cycles and morphogenesis, and cell division in cultured mammalian cells. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2151