The domain within your query sequence starts at position 1 and ends at position 183; the E-value for the DUF2233 domain shown below is 2.1e-35.

MSTGECLGNVVSDGRLVSSSGGLQNAQFGIRRDGTIVTGYLSEEEVLDPVNPFVQLLSGV
VWLIRNGNIYINESQAIECDETQETGSFSKFVNVMSARTAVGHDREGQLILFHADGQTEQ
RGLNLWEMAEFLRQQDVVNAINLDGGGSATFVLNGTLASYPSDHCQDNMWRCPRQVSTVV
CVH

DUF2233

DUF2233
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2233