The domain within your query sequence starts at position 53 and ends at position 130; the E-value for the DUF2315 domain shown below is 7.5e-34.
CHDWIGPPDKCSNLRPVHFHIPENESPLEQRLRELRQETQEWNQQFWAKQNLSFNKEKEE FIYSRLQAKGAGLRTESG
DUF2315 |
![]() |
---|
PFAM accession number: | PF10231 |
---|---|
Interpro abstract (IPR018796): | Apoptogenic protein 1 (Apop1, also known as cytochrome c oxidase assembly factor 8), previously thought to induces apoptosis through the Cyclophilin-D-dependent pathway [ (PUBMED:16782708) ], is required for cytochrome c oxidase (COX) assembly and function. Apop1 is controlled by the ubiquitination-proteasome system (UPS) [ (PUBMED:30552096) ]. In Drosophila melanogaster, Apop1 is also involved in neurological impairment, COX enzymatic activity, and resistance to oxidative stress conditions [ (PUBMED:31555154) ]. |
GO process: | intrinsic apoptotic signaling pathway (GO:0097193) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2315