The domain within your query sequence starts at position 1 and ends at position 61; the E-value for the DUF2340 domain shown below is 1.6e-14.
XNFKPVVYHGVNLHQTVKEFIIFLKQDVPLRTSLPPPLRNYKYDTLKILHQAHKAKPGHS P
DUF2340 |
 |
|---|
| PFAM accession number: | PF10209 |
|---|---|
| Interpro abstract (IPR018794): | This entry consists of small proteins of approximately 150 amino acids whose function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2340