The domain within your query sequence starts at position 8 and ends at position 93; the E-value for the DUF2340 domain shown below is 3.7e-25.
LTVRLIRSFEHRNFKPVVYHGVNLHQTVKEFIIFLKQDVPLRTSLPPPLRNYKYDTLKIL HQAHKAKPVKLKLHSSVEKIISDTKL
DUF2340 |
---|
PFAM accession number: | PF10209 |
---|---|
Interpro abstract (IPR018794): | This entry consists of small proteins of approximately 150 amino acids whose function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2340