The domain within your query sequence starts at position 19 and ends at position 175; the E-value for the DUF2347 domain shown below is 1.6e-10.

IVVVGFHHKKGCQVEFSYPPLIPGDGHDSHTLPEEWKYLPFLALPDGAHNYQEDTVFFHL
PPRNGNGATVYGISCYRQIEAKALKVRQADITRETVQKSVCVLSKLPLYGLLQAKLQLIT
HAYFEEKDFSQISILKELYEHMNSSLGGASLEGSQVY

DUF2347

DUF2347
PFAM accession number:PF09804
Interpro abstract (IPR018626):

Members of this family of hypothetical proteins have no known function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2347